McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM168-1:1

Chromosome

chr7

Gene Name

lnc-TMEM168-1

Start

112735165

CPC Label

noncoding

End

112738693

Cancer

CCRC

Strand

-

Peptide

SSQTLLTPGMMENLDHEMGHAMHSMLGR

Modified Peptide

n[230]SSQTLLTPGMMENLDHEMGHAMHSMLGR

Peptide Length

28

ORF Length

118

Open Reading Frame (ORF)

LAIIHESEGLLGCIYFDFFQQADKPHQDCHFRIHRGRLKEDRDYQLPVIVLMLNLPHSSRSSQTLLTPGMMENLDHEMGHAMHSMLGRTSYQHITGTRCPIDFAGVPSILIEYFANDY

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0374916

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

-0.346556517