McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM167A-3:4

Chromosome

chr5

Gene Name

lnc-TMEM167A-3

Start

82913891

CPC Label

noncoding

End

82975716

Cancer

EOGC

Strand

-

Peptide

GGEEIFFPDAGSPYCCVILLLAR

Modified Peptide

n[145]GGEEIFFPDAGSPYCCVILLLAR

Peptide Length

23

ORF Length

38

Open Reading Frame (ORF)

MVRAHLKKGGEEIFFPDAGSPYCCVILLLARVGPHSLS

Conservation Score

0.078

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.226072

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.26

PhyloCSF Frame 3

0

CNTI Score

-0.335517966