McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM167A-3:2

Chromosome

chr5

Gene Name

lnc-TMEM167A-3

Start

82971250

CPC Label

coding

End

82975716

Cancer

OV

Strand

-

Peptide

GLHGSSLTGFYSLR

Modified Peptide

n[145]GLHGSSLTGFYSLR

Peptide Length

14

ORF Length

51

Open Reading Frame (ORF)

MFCPHVKQRQLLCLCALQARGPDCPLSTRAVLQSTGRGLHGSSLTGFYSLR

Conservation Score

0.403

PhyloCSF Frame 1

0

No. of Spectra

13

CPC Coding Probability

0.549763

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9797

PhyloCSF Frame 3

0

CNTI Score

-0.323775646