McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM163-2:1

Chromosome

chr2

Gene Name

lnc-TMEM163-2

Start

134449263

CPC Label

noncoding

End

134451739

Cancer

PRAD

Strand

-

Peptide

EGFLNGRK

Modified Peptide

Peptide Length

8

ORF Length

46

Open Reading Frame (ORF)

LLQEQLPCQWNSGALPLNTGLGGMKEGFLNGRKVFFWAVWPGQGGL

Conservation Score

0.08

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.141742

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9971

PhyloCSF Frame 3

0

CNTI Score

-0.326147767