McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM161B-10:1

Chromosome

chr5

Gene Name

lnc-TMEM161B-10

Start

88887391

CPC Label

noncoding

End

88904052

Cancer

OV

Strand

-

Peptide

KALVPKK

Modified Peptide

n[145]KALVPKK

Peptide Length

7

ORF Length

39

Open Reading Frame (ORF)

LQEFFYLSGFGQQSPQQVLTGTTSWRSRKALVPKKSCKL

Conservation Score

1

PhyloCSF Frame 1

-2.524

No. of Spectra

69

CPC Coding Probability

0.00973782

PhyloCSF Frame 2 

-2.305

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

-2.649

CNTI Score

-0.390440747