McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM156-2:5

Chromosome

chr4

Gene Name

lnc-TMEM156-2

Start

39135512

CPC Label

noncoding

End

39182206

Cancer

OSCC

Strand

-

Peptide

LGCSNVIR

Modified Peptide

n[145]LGCSNVIR

Peptide Length

8

ORF Length

69

Open Reading Frame (ORF)

MVRCSRFTLYFPCPSSGISHFSKIFYSLFVCFCLRQGLIPSPRLGCSNVIRVHCSLDLLGSIFPPQPPK

Conservation Score

0.945

PhyloCSF Frame 1

0

No. of Spectra

62

CPC Coding Probability

0.466322

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9984

PhyloCSF Frame 3

0

CNTI Score

-0.354277336