McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM151A-4:1

Chromosome

chr11

Gene Name

lnc-TMEM151A-4

Start

66348214

CPC Label

noncoding

End

66364804

Cancer

LUAD

Strand

+

Peptide

TSSTMLR

Modified Peptide

n[230]TSSTMLR

Peptide Length

7

ORF Length

88

Open Reading Frame (ORF)

LGGKHLHFHILPIWSSKLEVRGPRAKTHTEYLVSARNCVRHEGWALEETQVLSLRVSTGDLGCKEEKMQKFISCQIALARTSSTMLRR

Conservation Score

0.852

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0719753

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9945

PhyloCSF Frame 3

0

CNTI Score

-0.325217599