McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM151A-1:1

Chromosome

chr11

Gene Name

lnc-TMEM151A-1

Start

66312852

CPC Label

noncoding

End

66319237

Cancer

OV

Strand

+

Peptide

LIPLEYAVR

Modified Peptide

n[145]LIPLEYAVR

Peptide Length

9

ORF Length

55

Open Reading Frame (ORF)

LIPLEYAVRRRARMRRGLRPTSSLSANPVGFTFKRDPESDHSWTPSLPPTPGPGG

Conservation Score

0.962

PhyloCSF Frame 1

-2.561

No. of Spectra

1

CPC Coding Probability

0.0229984

PhyloCSF Frame 2 

-1.503

CNTI Index

noncoding

Max Probability

0.1931

PhyloCSF Frame 3

-4.023

CNTI Score

-0.400193626