McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM150B-2:1

Chromosome

chr19

Gene Name

lnc-TMEM150B-2

Start

55312028

CPC Label

noncoding

End

55312495

Cancer

OV

Strand

-

Peptide

AGFCVHPPPDMFLGPYLQIHSWGAR

Modified Peptide

n[145]AGFCVHPPPDMFLGPYLQIHSWGAR

Peptide Length

25

ORF Length

66

Open Reading Frame (ORF)

LGTACGAPSLQGKAGFCVHPPPDMFLGPYLQIHSWGARKGGGGGSPPSPAPWGQGRGVPLVARSFL

Conservation Score

1

PhyloCSF Frame 1

10.706

No. of Spectra

1

CPC Coding Probability

0.167338

PhyloCSF Frame 2 

-3.71

CNTI Index

noncoding

Max Probability

0.6423

PhyloCSF Frame 3

-3.299

CNTI Score

-0.440722371