McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM144-3:1

Chromosome

chr4

Gene Name

lnc-TMEM144-3

Start

158270377

CPC Label

noncoding

End

158278601

Cancer

OV

Strand

+

Peptide

VPDALDTR

Modified Peptide

n[145]VPDALDTR

Peptide Length

8

ORF Length

85

Open Reading Frame (ORF)

LEDLKKLEPILKNILTYNKEFPFDIQPVPLRRILAPGKEENLEFEEEEEGGAGAGSPDSFPARVPDALDTRVAIGTRNDITHYQN

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.138822

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.7128

PhyloCSF Frame 3

0

CNTI Score

0.63629871