McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM138-3:1

Chromosome

chr11

Gene Name

lnc-TMEM138-3

Start

61376988

CPC Label

noncoding

End

61379622

Cancer

OV

Strand

+

Peptide

MQKLARPGGACL

Modified Peptide

n[145]M[147]QKLARPGGACL

Peptide Length

12

ORF Length

51

Open Reading Frame (ORF)

MVAHACNPSTLVRLRWADHLRLGVRDQPGQHSEPLSLLKMQKLARPGGACL

Conservation Score

0.078

PhyloCSF Frame 1

0

No. of Spectra

23

CPC Coding Probability

0.0468741

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7575

PhyloCSF Frame 3

0

CNTI Score

-0.378565952