McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM132D-2:1

Chromosome

chr12

Gene Name

lnc-TMEM132D-2

Start

130067060

CPC Label

noncoding

End

130068553

Cancer

PRAD

Strand

-

Peptide

MNTNEQAVAEACHLLPSASGEASGSCQSWRK

Modified Peptide

M[147]NTNEQAVAEACHLLPSASGEASGSCQSWRK

Peptide Length

31

ORF Length

70

Open Reading Frame (ORF)

MNTNEQAVAEACHLLPSASGEASGSCQSWRKVKGSQCITRQEQEQERCQAPSNNQLSSELTEQDLTHLQG

Conservation Score

0.298

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.154365

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7292

PhyloCSF Frame 3

0

CNTI Score

-0.312008582