McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM132B-2:11

Chromosome

chr12

Gene Name

lnc-TMEM132B-2

Start

125983701

CPC Label

noncoding

End

125986234

Cancer

CCRC

Strand

+

Peptide

LNQGGLR

Modified Peptide

n[230]LNQGGLR

Peptide Length

7

ORF Length

36

Open Reading Frame (ORF)

LNQGGLRNTEEDLDVPPFMMALEPVASLLLALAVFS

Conservation Score

0.398

PhyloCSF Frame 1

0

No. of Spectra

21

CPC Coding Probability

0.0896645

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

0

CNTI Score

-0.370975409