McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM132B-19:1

Chromosome

chr12

Gene Name

lnc-TMEM132B-19

Start

126912033

CPC Label

noncoding

End

126912322

Cancer

HCC

Strand

+

Peptide

GGDIQPVSVK

Modified Peptide

GGDIQPVSVK

Peptide Length

10

ORF Length

51

Open Reading Frame (ORF)

LGSKGKGGDIQPVSVKVGDKVLLPEYRGIKVSLDDKDSFFFRDNNILGKYL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.039453

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7728

PhyloCSF Frame 3

0

CNTI Score

-0.390016343