McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM131-3:1

Chromosome

chr2

Gene Name

lnc-TMEM131-3

Start

98135392

CPC Label

noncoding

End

98138512

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

CLNKQPK

Modified Peptide

n[145]CLNKQPK

Peptide Length

7

ORF Length

51

Open Reading Frame (ORF)

LSCLWLVCCSRCLNKQPKRADGRHWPRKASQKGNVYMEGSREAKEHLPELT

Conservation Score

0.214

PhyloCSF Frame 1

-4.709

No. of Spectra

46

CPC Coding Probability

0.034141

PhyloCSF Frame 2 

-3.523

CNTI Index

noncoding

Max Probability

0.9956

PhyloCSF Frame 3

-5.353

CNTI Score

-0.339804314