McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM130-1:1

Chromosome

chr7

Gene Name

lnc-TMEM130-1

Start

98654169

CPC Label

noncoding

End

98657584

Cancer

EOGC

Strand

-

Peptide

ILIQCELILINYICK

Modified Peptide

n[145]ILIQCELILINYICK

Peptide Length

15

ORF Length

33

Open Reading Frame (ORF)

MILIQCELILINYICKCPISSCRVKPILVSTCF

Conservation Score

0.012

PhyloCSF Frame 1

-5.302

No. of Spectra

33

CPC Coding Probability

0.00852026

PhyloCSF Frame 2 

-4.628

CNTI Index

noncoding

Max Probability

0.9977

PhyloCSF Frame 3

0

CNTI Score

-0.428059969