McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM129-4:1

Chromosome

chr4

Gene Name

lnc-TMEM129-4

Start

1743496

CPC Label

coding

End

1763552

Cancer

OV

Strand

-

Peptide

AWIASEPGRVVGTQMDVPSRDGAGGGR

Modified Peptide

n[145]AWIASEPGRVVGTQMDVPSRDGAGGGR

Peptide Length

27

ORF Length

100

Open Reading Frame (ORF)

LGVTKAPELCGCGPQGGQAPPGHRFGLGRGHSPGSSSLLGRRTLTWRAGCTGRSLRAWIASEPGRVVGTQMDVPSRDGAGGGRSARQVPAVWVCSGGGCG

Conservation Score

0.014

PhyloCSF Frame 1

-3.742

No. of Spectra

1

CPC Coding Probability

0.694908

PhyloCSF Frame 2 

-4.097

CNTI Index

noncoding

Max Probability

0.0611

PhyloCSF Frame 3

-2.856

CNTI Score

-0.246766417