McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM129-1:1

Chromosome

chr4

Gene Name

lnc-TMEM129-1

Start

1738579

CPC Label

coding

End

1740983

Cancer

OV

Strand

-

Peptide

LLLDIAAR

Modified Peptide

n[145]LLLDIAAR

Peptide Length

8

ORF Length

157

Open Reading Frame (ORF)

LDFSFGKFLLLLNFLLRKEKQTFRMRRQPKRWVPETAQGMRQGTRAPGGEIRRELEPGPEVPEEAAPNTLEPRVRPGSRYGELQDVRRASWWSWRDCKGQAVTCRRLTLSLRQIPTVAPPGAQAFGRPDEAWCSRPARHLQRLLLDIAARRGQGGVG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.686463

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9464

PhyloCSF Frame 3

9.172

CNTI Score

-0.289383428