McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM126B-4:1

Chromosome

chr11

Gene Name

lnc-TMEM126B-4

Start

84883379

CPC Label

noncoding

End

84893555

Cancer

LUAD

Strand

+

Peptide

LLPTNSLFK

Modified Peptide

n[230]LLPTNSLFK

Peptide Length

9

ORF Length

64

Open Reading Frame (ORF)

LLPTNSLFKIPTCPFSLLPFYFLYLPTLATSSLYHHTLKQRKRREEKTNQRIRQVFHSPPRTLK

Conservation Score

0.698

PhyloCSF Frame 1

-5.573

No. of Spectra

18

CPC Coding Probability

0.0547359

PhyloCSF Frame 2 

-6.243

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

-5.177

CNTI Score

-0.418766937