McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM126B-2:1

Chromosome

chr11

Gene Name

lnc-TMEM126B-2

Start

84720825

CPC Label

noncoding

End

84800701

Cancer

PRAD

Strand

+

Peptide

WGLHHMQPSYFR

Modified Peptide

‚Äč

Peptide Length

12

ORF Length

57

Open Reading Frame (ORF)

LKKKKKKKTYCSSRFETSYLKTRWGLHHMQPSYFRACLFLFLDINRTLHANQAGSVS

Conservation Score

1

PhyloCSF Frame 1

-3.855

No. of Spectra

71

CPC Coding Probability

0.0175834

PhyloCSF Frame 2 

-3.387

CNTI Index

noncoding

Max Probability

0.9605

PhyloCSF Frame 3

-4.016

CNTI Score

-0.416115131