McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM120B-1:3

Chromosome

chr12

Gene Name

lnc-TMEM120B-1

Start

121664124

CPC Label

noncoding

End

121696788

Cancer

CCRC

Strand

+

Peptide

NLAAPLK

Modified Peptide

n[230]NLAAPLK

Peptide Length

7

ORF Length

36

Open Reading Frame (ORF)

MNLAAPLKMLISLKHPFYCLMALSREVLTVLELPFI

Conservation Score

0.601

PhyloCSF Frame 1

-3.998

No. of Spectra

1

CPC Coding Probability

0.0839511

PhyloCSF Frame 2 

-3.219

CNTI Index

noncoding

Max Probability

0.9951

PhyloCSF Frame 3

-2.831

CNTI Score

-0.335237441