McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM106C-8:1

Chromosome

chr12

Gene Name

lnc-TMEM106C-8

Start

48002050

CPC Label

noncoding

End

48003396

Cancer

OV

Strand

+

Peptide

NGAFLER

Modified Peptide

n[145]NGAFLER

Peptide Length

7

ORF Length

65

Open Reading Frame (ORF)

MNGAFLERTQSPIHRSPRGTSLNKYGQRFSPIWKPSLPISQCKQASQRRIEISPLSQGHFRRRGL

Conservation Score

1

PhyloCSF Frame 1

-0.225

No. of Spectra

6

CPC Coding Probability

0.14417

PhyloCSF Frame 2 

2.994

CNTI Index

noncoding

Max Probability

0.9724

PhyloCSF Frame 3

0.08

CNTI Score

-0.320104606