McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM106C-3:1

Chromosome

chr12

Gene Name

lnc-TMEM106C-3

Start

47905104

CPC Label

noncoding

End

47907598

Cancer

BRCA-Luminal B

Strand

+

Peptide

ELSLSFPGPWSRVPPSPPAPWHRR

Modified Peptide

n[145]ELSLSFPGPWSRVPPSPPAPWHRR

Peptide Length

24

ORF Length

85

Open Reading Frame (ORF)

LLLLQNARKLSLIPQIRVKYPGGPKWKPELRHCSHPISPWQRPRLTTFPACRESHPRELSLSFPGPWSRVPPSPPAPWHRREGKR

Conservation Score

0.968

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.149592

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7253

PhyloCSF Frame 3

1.986

CNTI Score

-0.304977514