McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM105-2:6

Chromosome

chr17

Gene Name

lnc-TMEM105-2

Start

81374761

CPC Label

coding

End

81385286

Cancer

CRC

Strand

-

Peptide

HFSSLQPPPPR

Modified Peptide

Peptide Length

11

ORF Length

38

Open Reading Frame (ORF)

LLTTVSSSFSFETESRFVAQAGVQWRHFSSLQPPPPRF

Conservation Score

0.132

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.761963

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8015

PhyloCSF Frame 3

0

CNTI Score

-0.330600422