McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM105-2:5

Chromosome

chr17

Gene Name

lnc-TMEM105-2

Start

81376000

CPC Label

noncoding

End

81385360

Cancer

OV

Strand

-

Peptide

NQFQVRRSGTALLNPVFFL

Modified Peptide

n[145]NQFQVRRSGTALLNPVFFL

Peptide Length

19

ORF Length

34

Open Reading Frame (ORF)

MRLVPGSLRATRKGRNQFQVRRSGTALLNPVFFL

Conservation Score

0.026

PhyloCSF Frame 1

-3.897

No. of Spectra

5

CPC Coding Probability

0.404466

PhyloCSF Frame 2 

-2.394

CNTI Index

noncoding

Max Probability

0.8986

PhyloCSF Frame 3

-3.698

CNTI Score

-0.355633592