McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM105-2:22

Chromosome

chr17

Gene Name

lnc-TMEM105-2

Start

81387811

CPC Label

noncoding

End

81394033

Cancer

OSCC

Strand

-

Peptide

SPAPAQAGSQVGGVGR

Modified Peptide

n[145]SPAPAQAGSQVGGVGR

Peptide Length

16

ORF Length

154

Open Reading Frame (ORF)

LPPPDQAWAEAQGKGAEAGHRGARLVRGQTWVGGLSSRHTRPPAPQPVELGSPRRSPAPAQAGSQVGGVGRQKSQGSWGRLRLYLKATVSSTDLGRGCKCFKETRAAEKRDSEARGTAFSASPPARGSPLLQLPVLSNQVRRLPGPLPTLKVAC

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.316779

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5087

PhyloCSF Frame 3

0

CNTI Score

-0.253712584