McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM105-2:16

Chromosome

chr17

Gene Name

lnc-TMEM105-2

Start

81383009

CPC Label

noncoding

End

81385363

Cancer

OV

Strand

-

Peptide

GHRLANMGAGVGSRYEQR

Modified Peptide

n[145]GHRLANM[147]GAGVGSRYEQR

Peptide Length

18

ORF Length

60

Open Reading Frame (ORF)

LHPSQDPRLQAGNPMGASGALGLHRRGSSVTRGSRGHRLANMGAGVGSRYEQRRPRSLRL

Conservation Score

0.014

PhyloCSF Frame 1

-4.669

No. of Spectra

1

CPC Coding Probability

0.117681

PhyloCSF Frame 2 

-3.925

CNTI Index

noncoding

Max Probability

0.5896

PhyloCSF Frame 3

-4.252

CNTI Score

-0.311755107