McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM101-1:2

Chromosome

chr17

Gene Name

lnc-TMEM101-1

Start

44023688

CPC Label

noncoding

End

44033993

Cancer

LUAD

Strand

-

Peptide

AGLWEEAR

Modified Peptide

n[230]AGLWEEAR

Peptide Length

8

ORF Length

37

Open Reading Frame (ORF)

LLPWMQGLKAGDFLSLSHMLTLGAAASLRAGLWEEAR

Conservation Score

0.114

PhyloCSF Frame 1

-5.548

No. of Spectra

2

CPC Coding Probability

0.0221853

PhyloCSF Frame 2 

-3.876

CNTI Index

coding

Max Probability

0.6732

PhyloCSF Frame 3

-4.23

CNTI Score

0.724992573