McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM100-5:1

Chromosome

chr17

Gene Name

lnc-TMEM100-5

Start

55683871

CPC Label

noncoding

End

55684184

Cancer

OV

Strand

-

Peptide

LEQFGGQR

Modified Peptide

n[145]LEQFGGQR

Peptide Length

8

ORF Length

56

Open Reading Frame (ORF)

LEQFGGQRFLNTSFPWDGLQHVGPVRVYPVRHSTDVYVGSQFPLLQDEKIQKYIYI

Conservation Score

0.258

PhyloCSF Frame 1

-5.974

No. of Spectra

1

CPC Coding Probability

0.0161923

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5887

PhyloCSF Frame 3

0

CNTI Score

-0.57700154