McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM100-3:1

Chromosome

chr17

Gene Name

lnc-TMEM100-3

Start

55685228

CPC Label

noncoding

End

55687598

Cancer

OV

Strand

-

Peptide

LDFTVYIAISILGK

Modified Peptide

n[145]LDFTVYIAISILGK

Peptide Length

14

ORF Length

34

Open Reading Frame (ORF)

LDFTVYIAISILGKAILQQVSRKFQRFPYFPVFF

Conservation Score

0.513

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0829447

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9951

PhyloCSF Frame 3

0

CNTI Score

-0.361322395