McDonnell Genome Institute

Washington University

Transcript

lnc-TMED5-5:1

Chromosome

chr1

Gene Name

lnc-TMED5-5

Start

93077900

CPC Label

noncoding

End

93118420

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

TQLLNTLAR

Modified Peptide

n[145]TQLLNTLAR

Peptide Length

9

ORF Length

39

Open Reading Frame (ORF)

LNLVFKYKTQLLNTLARCLPFREKIYLFSMRIHKTRVLV

Conservation Score

0.87

PhyloCSF Frame 1

-2.801

No. of Spectra

1

CPC Coding Probability

0.0872555

PhyloCSF Frame 2 

-3.918

CNTI Index

noncoding

Max Probability

0.9955

PhyloCSF Frame 3

-3.657

CNTI Score

-0.373683074