McDonnell Genome Institute

Washington University

Transcript

lnc-TMCO5A-4:1

Chromosome

chr15

Gene Name

lnc-TMCO5A-4

Start

37708313

CPC Label

noncoding

End

37713122

Cancer

EOGC

Strand

+

Peptide

DDLGYLAEEIPK

Modified Peptide

n[145]DDLGYLAEEIPK

Peptide Length

12

ORF Length

94

Open Reading Frame (ORF)

LHFTPALGICGTLNLRDDLGYLAEEIPKQQSVQDVAWLFLTAYSHMHEQRKYLKWELIFKRKAEHKSLENLQPSHVIEKKSPFAVEKFKPAIEI

Conservation Score

0.893

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0475488

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4614

PhyloCSF Frame 3

0

CNTI Score

-0.366784883