McDonnell Genome Institute

Washington University

Transcript

lnc-TMCC1-10:2

Chromosome

chr3

Gene Name

lnc-TMCC1-10

Start

130097781

CPC Label

noncoding

End

130111433

Cancer

OV

Strand

-

Peptide

LAAAATSLDTFGSSQSQAR

Modified Peptide

n[145]LAAAATSLDTFGSSQSQAR

Peptide Length

19

ORF Length

106

Open Reading Frame (ORF)

MTFPQRGHTRFLTKPSPLQLPHPWTHSVPHKAKLAAAATSLDTFGSSQSQARGSCHIPGHTRFLTKPSPLQLPHPWACGAAGAFLKTGIKVLGTWQKGDTWRPNAG

Conservation Score

0.057

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.159783

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9791

PhyloCSF Frame 3

0

CNTI Score

-0.284133361