McDonnell Genome Institute

Washington University

Transcript

lnc-TMC7-6:2

Chromosome

chr16

Gene Name

lnc-TMC7-6

Start

18571215

CPC Label

noncoding

End

18580252

Cancer

OV

Strand

+

Peptide

MFPTLQSQDGAWIRPHSPVYLQR

Modified Peptide

n[145]MFPTLQSQDGAWIRPHSPVYLQR

Peptide Length

23

ORF Length

118

Open Reading Frame (ORF)

LPRDLATDRRWDPRRQKAPMAAPAEPCAGQGVWNQTEPEPAATSLLSLCFLRTAGVWVPPMYLWVLGPIYLLFIHHHGRGYLRMFPTLQSQDGAWIRPHSPVYLQRGCRSLENPTGNA

Conservation Score

1

PhyloCSF Frame 1

0.17

No. of Spectra

4

CPC Coding Probability

0.132735

PhyloCSF Frame 2 

-2.121

CNTI Index

noncoding

Max Probability

0.6414

PhyloCSF Frame 3

8.729

CNTI Score

-0.326598449