McDonnell Genome Institute

Washington University

Transcript

lnc-TMC7-2:3

Chromosome

chr16

Gene Name

lnc-TMC7-2

Start

18801829

CPC Label

noncoding

End

18804885

Cancer

OV

Strand

+

Peptide

ETLSFCFFK

Modified Peptide

n[145]ETLSFCFFK

Peptide Length

9

ORF Length

49

Open Reading Frame (ORF)

LKWECNLSPGVRDQPGQHRETLSFCFFKLPRFQKVSSFPKSILTNKFRT

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

16

CPC Coding Probability

0.0344237

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9897

PhyloCSF Frame 3

0

CNTI Score

-0.37102758