McDonnell Genome Institute

Washington University

Transcript

lnc-TMC6-2:1

Chromosome

chr17

Gene Name

lnc-TMC6-2

Start

77528124

CPC Label

coding

End

77536591

Cancer

OV

Strand

-

Peptide

GLTICPTTETSSWMASRPLQSWR

Modified Peptide

n[145]GLTICPTTETSSWM[147]ASRPLQSWR

Peptide Length

23

ORF Length

70

Open Reading Frame (ORF)

MGLTICPTTETSSWMASRPLQSWRYRNEGVWEGNLAREPPVCQGDPPSPLEATEHQCPPRRCLFHGRVRT

Conservation Score

0.086

PhyloCSF Frame 1

-4.633

No. of Spectra

2

CPC Coding Probability

0.924826

PhyloCSF Frame 2 

-4.529

CNTI Index

noncoding

Max Probability

0.1924

PhyloCSF Frame 3

-4.751

CNTI Score

-0.266061337