McDonnell Genome Institute

Washington University

Transcript

lnc-TMC6-1:1

Chromosome

chr17

Gene Name

lnc-TMC6-1

Start

77799106

CPC Label

noncoding

End

77802715

Cancer

OSCC

Strand

-

Peptide

TAEQHGEEETK

Modified Peptide

n[145]TAEQHGEEETK

Peptide Length

11

ORF Length

89

Open Reading Frame (ORF)

LINAPAEKRNCPLKWLGKRLGGRVDINQSRPLRRTAEQHGEEETKEGGLPNSLEYYGGRSDQLMALDAMRTLQLLASSGQELSAAESGV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

52

CPC Coding Probability

0.0131152

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9604

PhyloCSF Frame 3

0

CNTI Score

-0.372195152