McDonnell Genome Institute

Washington University

Transcript

lnc-TMC5-1:1

Chromosome

chr16

Gene Name

lnc-TMC5-1

Start

19501688

CPC Label

noncoding

End

19502286

Cancer

PRAD

Strand

+

Peptide

KFASHCHIAMGTGGLLK

Modified Peptide

KFASHCHIAMGTGGLLK

Peptide Length

17

ORF Length

38

Open Reading Frame (ORF)

MPMPIQSVTKKFASHCHIAMGTGGLLKSLSSCCKCEKR

Conservation Score

0.026

PhyloCSF Frame 1

-3.945

No. of Spectra

3

CPC Coding Probability

0.105183

PhyloCSF Frame 2 

-5.125

CNTI Index

noncoding

Max Probability

0.9764

PhyloCSF Frame 3

-5.636

CNTI Score

-0.392018406