McDonnell Genome Institute

Washington University

Transcript

lnc-TM4SF20-1:2

Chromosome

chr2

Gene Name

lnc-TM4SF20-1

Start

227245709

CPC Label

noncoding

End

227325186

Cancer

LUAD

Strand

-

Peptide

KMGSFLPPNYAVGSGLK

Modified Peptide

KM[147]GSFLPPNYAVGSGLK

Peptide Length

17

ORF Length

46

Open Reading Frame (ORF)

MRRKKMGSFLPPNYAVGSGLKECFQGKPVCLSLPFHLDLIIQQSIY

Conservation Score

0.062

PhyloCSF Frame 1

-4.628

No. of Spectra

14

CPC Coding Probability

0.0345152

PhyloCSF Frame 2 

-5.313

CNTI Index

noncoding

Max Probability

0.9975

PhyloCSF Frame 3

-4.261

CNTI Score

-0.381013674