McDonnell Genome Institute

Washington University

Transcript

lnc-TM2D2-7:1

Chromosome

chr8

Gene Name

lnc-TM2D2-7

Start

38898633

CPC Label

noncoding

End

38901086

Cancer

OSCC

Strand

-

Peptide

LSTTVLDAGR

Modified Peptide

n[145]LSTTVLDAGR

Peptide Length

10

ORF Length

46

Open Reading Frame (ORF)

LSTTVLDAGRQREAEGLGWQENTGVSRRLKQACALGMAQRVSAVNF

Conservation Score

1

PhyloCSF Frame 1

-4.197

No. of Spectra

1

CPC Coding Probability

0.0419966

PhyloCSF Frame 2 

-4.742

CNTI Index

noncoding

Max Probability

0.1261

PhyloCSF Frame 3

-5.709

CNTI Score

-0.303158615