McDonnell Genome Institute

Washington University

Transcript

lnc-TM2D2-4:1

Chromosome

chr8

Gene Name

lnc-TM2D2-4

Start

39157537

CPC Label

noncoding

End

39158701

Cancer

EOGC

Strand

-

Peptide

ETGLVSGEAR

Modified Peptide

n[145]ETGLVSGEAR

Peptide Length

10

ORF Length

73

Open Reading Frame (ORF)

LQGEDDKKQLKKDFNSMLEYLHPDAPASSMYEEDPPNGHPGEQRHCDRETGLVSGEARGPGTCEASVWAGQDD

Conservation Score

1

PhyloCSF Frame 1

-4.099

No. of Spectra

22

CPC Coding Probability

0.317558

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9975

PhyloCSF Frame 3

0

CNTI Score

-0.29793516