McDonnell Genome Institute

Washington University

Transcript

lnc-TM2D2-3:1

Chromosome

chr8

Gene Name

lnc-TM2D2-3

Start

38844865

CPC Label

noncoding

End

38846439

Cancer

OV

Strand

-

Peptide

LDNTPQDK

Modified Peptide

n[145]LDNTPQDK

Peptide Length

8

ORF Length

91

Open Reading Frame (ORF)

MSLLMRCERHSFFFFFFFFLRWSLALSPRLEYSGAVSAHCKLRLPGSRHSPASASPSSWDYSMGDRVRLCLKKNQQKIKLDNTPQDKLQMY

Conservation Score

0.992

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.143397

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9132

PhyloCSF Frame 3

0

CNTI Score

-0.449864872