McDonnell Genome Institute

Washington University

Transcript

lnc-TLX1-7:1

Chromosome

chr10

Gene Name

lnc-TLX1-7

Start

101233543

CPC Label

noncoding

End

101234921

Cancer

BRCA-Basal-like

Strand

+

Peptide

LDVTVILPR

Modified Peptide

n[145]LDVTVILPR

Peptide Length

9

ORF Length

52

Open Reading Frame (ORF)

LDVTVILPRMCCFVCLSCLSLSICCELGKEGPESPLHAPMPAQHTPRGPSIC

Conservation Score

1

PhyloCSF Frame 1

-4.426

No. of Spectra

2

CPC Coding Probability

0.156144

PhyloCSF Frame 2 

-6.174

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

-4.476

CNTI Score

-0.362448966