McDonnell Genome Institute

Washington University

Transcript

lnc-TLR4-3:6

Chromosome

chr9

Gene Name

lnc-TLR4-3

Start

117759454

CPC Label

noncoding

End

117780593

Cancer

OV

Strand

+

Peptide

ATLLAEGTRIFITEDPK

Modified Peptide

n[145]ATLLAEGTRIFITEDPK

Peptide Length

17

ORF Length

45

Open Reading Frame (ORF)

MLDFMGVYKTFSGIAFPLVRNFFSYFFKATLLAEGTRIFITEDPK

Conservation Score

0.195

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0476039

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.228

PhyloCSF Frame 3

0

CNTI Score

-0.372222499