McDonnell Genome Institute

Washington University

Transcript

lnc-TLR10-2:1

Chromosome

chr4

Gene Name

lnc-TLR10-2

Start

38657827

CPC Label

noncoding

End

38663697

Cancer

CRC

Strand

-

Peptide

KSHFKQLISEHCVR

Modified Peptide

KSHFKQLISEHCVR

Peptide Length

14

ORF Length

76

Open Reading Frame (ORF)

LKHINHVFYLVHVGVDAKGKSEIGLSEKSVTQDKKGVVLIWKGQAAKEKKSHFKQLISEHCVRCPVGSCSNATCRK

Conservation Score

0.977

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0352368

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6554

PhyloCSF Frame 3

0

CNTI Score

-0.275102309