McDonnell Genome Institute

Washington University

Transcript

lnc-TLNRD1-3:1

Chromosome

chr15

Gene Name

lnc-TLNRD1-3

Start

80990004

CPC Label

noncoding

End

80993345

Cancer

OV

Strand

+

Peptide

RSEWQVGQLFSESHK

Modified Peptide

n[145]RSEWQVGQLFSESHK

Peptide Length

15

ORF Length

34

Open Reading Frame (ORF)

MSDVYPQSLAISFENSQLKRSEWQVGQLFSESHK

Conservation Score

0.037

PhyloCSF Frame 1

-3.14

No. of Spectra

1

CPC Coding Probability

0.0367511

PhyloCSF Frame 2 

-2.946

CNTI Index

noncoding

Max Probability

0.7797

PhyloCSF Frame 3

-4.078

CNTI Score

-0.389294323