McDonnell Genome Institute

Washington University

Transcript

lnc-TLN2-4:1

Chromosome

chr15

Gene Name

lnc-TLN2-4

Start

62843074

CPC Label

noncoding

End

62844631

Cancer

PRAD

Strand

+

Peptide

ASGMLALR

Modified Peptide

ASGM[147]LALR

Peptide Length

8

ORF Length

93

Open Reading Frame (ORF)

LTPEEPWFPPWQIVPRIFSPSFEVLGSGKASGMLALRSQHRLSACSILRFLEERYPLLTKGLAASETYQPKKFGDIPLRLKGSGPQSSESKRS

Conservation Score

0.16

PhyloCSF Frame 1

-0.02

No. of Spectra

1

CPC Coding Probability

0.033236

PhyloCSF Frame 2 

-3.997

CNTI Index

noncoding

Max Probability

0.3658

PhyloCSF Frame 3

-4.612

CNTI Score

-0.368963511