McDonnell Genome Institute

Washington University

Transcript

lnc-TLL1-4:5

Chromosome

chr4

Gene Name

lnc-TLL1-4

Start

166198270

CPC Label

noncoding

End

166456562

Cancer

OV

Strand

+

Peptide

LTFTGIAEIPLVQK

Modified Peptide

n[145]LTFTGIAEIPLVQK

Peptide Length

14

ORF Length

116

Open Reading Frame (ORF)

LFGLNLCTQRNYCKYLNKSCCLNLYFLIYVLLLSFTRLTFTGIAEIPLVQKSLQLSFLKNRIGNFPHFVTAVNFTCFNPLHVMKIFCISQSVIGVSFLRVGSMICLLMPITRARVY

Conservation Score

0.154

PhyloCSF Frame 1

-4.495

No. of Spectra

5

CPC Coding Probability

0.323907

PhyloCSF Frame 2 

-4.417

CNTI Index

noncoding

Max Probability

0.9985

PhyloCSF Frame 3

-5.189

CNTI Score

-0.338963111