McDonnell Genome Institute

Washington University

Transcript

lnc-TLK1-8:1

Chromosome

chr2

Gene Name

lnc-TLK1-8

Start

170431454

CPC Label

noncoding

End

170479012

Cancer

LUAD

Strand

-

Peptide

HLNLGGGGCSEPKSCHCTPASATEQDSVSK

Modified Peptide

n[230]HLNLGGGGCSEPKSCHCTPASATEQDSVSK

Peptide Length

30

ORF Length

68

Open Reading Frame (ORF)

LSLLKIQKLARHGGRRLWSQLLRRLRQEKHLNLGGGGCSEPKSCHCTPASATEQDSVSKKKEILPHPN

Conservation Score

0.018

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0433435

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9434

PhyloCSF Frame 3

0

CNTI Score

-0.382630843