McDonnell Genome Institute

Washington University

Transcript

lnc-TLK1-7:8

Chromosome

chr2

Gene Name

lnc-TLK1-7

Start

171323227

CPC Label

noncoding

End

171323834

Cancer

OV

Strand

-

Peptide

ESTPYFQGK

Modified Peptide

n[145]ESTPYFQGK

Peptide Length

9

ORF Length

47

Open Reading Frame (ORF)

LQRESTPYFQGKLQQAQGQSVLFFVLLLSIFSQFFFEIQRLISEIEF

Conservation Score

1

PhyloCSF Frame 1

-5.495

No. of Spectra

2

CPC Coding Probability

0.00361894

PhyloCSF Frame 2 

-3.768

CNTI Index

noncoding

Max Probability

0.5769

PhyloCSF Frame 3

-5.056

CNTI Score

-0.38042798